Lineage for d1ztgb_ (1ztg B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904496Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1904497Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1904498Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 1904589Protein automated matches [195910] (2 species)
    not a true protein
  7. 1904590Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)
  8. 1904599Domain d1ztgb_: 1ztg B: [241161]
    automated match to d3vkea_
    protein/DNA complex; protein/RNA complex

Details for d1ztgb_

PDB Entry: 1ztg (more details), 3 Å

PDB Description: human alpha polyC binding protein KH1
PDB Compounds: (B:) Poly(rC)-binding protein 1

SCOPe Domain Sequences for d1ztgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztgb_ d.51.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giltirllmhgkevgsiigkkgesvkrireesgarinisegncperiitltgptnaifka
famiidkleedins

SCOPe Domain Coordinates for d1ztgb_:

Click to download the PDB-style file with coordinates for d1ztgb_.
(The format of our PDB-style files is described here.)

Timeline for d1ztgb_: