Class a: All alpha proteins [46456] (289 folds) |
Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (3 families) |
Family a.149.1.2: PF0609-like [140675] (2 proteins) specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (47972) automatically mapped to Pfam PF11469 |
Protein Hypothetical protein PF0609 [140676] (1 species) SECSG target pfu-631545-001 |
Species Pyrococcus furiosus [TaxId:2261] [140677] (1 PDB entry) Uniprot Q8U363 2-125 |
Domain d1ztda1: 1ztd A:2-125 [125639] Other proteins in same PDB: d1ztda2, d1ztdb2, d1ztdb3 |
PDB Entry: 1ztd (more details), 2 Å
SCOPe Domain Sequences for d1ztda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztda1 a.149.1.2 (A:2-125) Hypothetical protein PF0609 {Pyrococcus furiosus [TaxId: 2261]} eidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkhak gdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserly ssqv
Timeline for d1ztda1: