Lineage for d1ztda1 (1ztd A:2-125)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.149: RNase III domain-like [69064] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.149.1: RNase III domain-like [69065] (2 families) 
Family a.149.1.2: PF0609-like [140675] (2 proteins)
specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (47972)Protein Hypothetical protein PF0609 [140676] (1 species)
SECSG target pfu-631545-001Species Pyrococcus furiosus [TaxId:2261] [140677] (1 PDB entry)
Uniprot Q8U363 2-125
Domain d1ztda1: 1ztd A:2-125 [125639]
Other proteins in same PDB: d1ztdb_
Details for d1ztda1
PDB Entry: 1ztd (more details), 2 Å
PDB Description: hypothetical protein pfu-631545-001 from pyrococcus furiosus
PDB Compounds: (A:) Hypothetical Protein Pfu-631545-001SCOPe Domain Sequences for d1ztda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztda1 a.149.1.2 (A:2-125) Hypothetical protein PF0609 {Pyrococcus furiosus [TaxId: 2261]}
eidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkhak
gdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserly
ssqv
SCOPe Domain Coordinates for d1ztda1:
Click to download the PDB-style file with coordinates for d1ztda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ztda1:
- d1ztda1 first appeared in SCOP 1.73
- d1ztda1 appears in SCOP 1.75
- d1ztda1 appears in SCOPe 2.02
- d1ztda1 appears in the current release, SCOPe 2.08
View in 3D
