Lineage for d1zsqa1 (1zsq A:73-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803630Family b.55.1.8: GRAM domain [101839] (1 protein)
  6. 2803631Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)
  7. 2803632Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries)
  8. 2803633Domain d1zsqa1: 1zsq A:73-198 [125616]
    Other proteins in same PDB: d1zsqa2
    automated match to d1zsqa1
    complexed with edo, pib

Details for d1zsqa1

PDB Entry: 1zsq (more details), 1.82 Å

PDB Description: crystal structure of mtmr2 in complex with phosphatidylinositol 3- phosphate
PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d1zsqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsqa1 b.55.1.8 (A:73-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
meeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvi
nrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlpl
fafeyk

SCOPe Domain Coordinates for d1zsqa1:

Click to download the PDB-style file with coordinates for d1zsqa1.
(The format of our PDB-style files is described here.)

Timeline for d1zsqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zsqa2