Details for d1zs8a2

PDB Entry: 1zs8 (more details), 3 Å

PDB Compounds: (A:) histocompatibility 2, M region locus 10.5

SCOPe Domain Sequences for d1zs8a2:

Sequence, based on SEQRES records: (download)

>d1zs8a2 d.19.1.1 (A:1-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M10 [TaxId: 10090]}
shwlktfrivimepgileprfiqvsyvdsiqyqgfdsrsetagmqpraawmkqeppeywk
netehamgasllarrtliymvtennnkkndyhtlqevfgcnvahdgsflgghygltyygy
dyiilnedlnswttegkvggkfnpdrtqgsvtegwrtylkgecterflrcldlgketllr

Sequence, based on observed residues (ATOM records): (download)

>d1zs8a2 d.19.1.1 (A:1-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M10 [TaxId: 10090]}
shwlktfrivimepgileprfiqvsyvdsiqyqgfdsrsgmqpraawmkqeppeywknet
ehamgasllarrtliymvtennnkkndyhtlqevfgcnvahdgsflgghygltyygydyi
ilnedlnswttegkvggkfnsvtegwrtylkgecterflrcldlgketllr

SCOPe Domain Coordinates for d1zs8a2:

Timeline for d1zs8a2:

• d1zs8a2 first appeared in SCOP 1.75
  
• d1zs8a2 appears in SCOPe 2.04
  
• d1zs8a2 appears in SCOPe 2.06
  
• d1zs8a2 appears in the current release, SCOPe 2.08
  

Thumbnails for d1zs8a2:

d1zs8a2 (click for larger image) View in 3D

d1zs8a2 in context of chain d1zs8a1 in context of chain View in 3D Domains from same chain: (mouse over for more information) d1zs8a1

d1zs8a2 in context of PDB d1zs8b_ in context of PDB d1zs8c1 in context of PDB d1zs8c2 in context of PDB d1zs8d_ in context of PDB d1zs8e1 in context of PDB d1zs8e2 in context of PDB d1zs8f_ in context of PDB d1zs8g1 in context of PDB d1zs8g2 in context of PDB d1zs8h_ in context of PDB d1zs8i1 in context of PDB d1zs8i2 in context of PDB d1zs8j_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d1zs8b_, d1zs8c1, d1zs8c2, d1zs8d_, d1zs8e1, d1zs8e2, d1zs8f_, d1zs8g1, d1zs8g2, d1zs8h_, d1zs8i1, d1zs8i2, d1zs8j_