Lineage for d1zrra1 (1zrr A:1-179)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330644Family b.82.1.6: Acireductone dioxygenase [82191] (1 protein)
    automatically mapped to Pfam PF03079
  6. 1330645Protein Acireductone dioxygenase [82192] (2 species)
  7. 1330646Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry)
    NMR-derived model
  8. 1330647Domain d1zrra1: 1zrr A:1-179 [125555]
    automatically matched to d1m4oa_
    complexed with ni

Details for d1zrra1

PDB Entry: 1zrr (more details)

PDB Description: residual dipolar coupling refinement of acireductone dioxygenase from klebsiella
PDB Compounds: (A:) E-2/E-2' protein

SCOPe Domain Sequences for d1zrra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}
saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla

SCOPe Domain Coordinates for d1zrra1:

Click to download the PDB-style file with coordinates for d1zrra1.
(The format of our PDB-style files is described here.)

Timeline for d1zrra1: