Lineage for d1zrha_ (1zrh A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123994Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2124080Protein automated matches [190189] (4 species)
    not a true protein
  7. 2124088Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)
  8. 2124093Domain d1zrha_: 1zrh A: [162574]
    automated match to d1vkja_
    complexed with a3p

Details for d1zrha_

PDB Entry: 1zrh (more details), 2.1 Å

PDB Description: Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
PDB Compounds: (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 1

SCOPe Domain Sequences for d1zrha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrha_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vapngsaqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehyshglgwyl
sqmpfswphqltvektpayftspkvpervysmnpsirlllilrdpservlsdytqvfynh
mqkhkpypsieeflvrdgrlnvdykalnrslyhvhmqnwlrffplrhihivdgdrlirdp
fpeiqkverflklspqinasnfyfnktkgfyclrdsgrdrclheskgrahpqvdpkllnk
lheyfhepnkkffelvgrtfdwh

SCOPe Domain Coordinates for d1zrha_:

Click to download the PDB-style file with coordinates for d1zrha_.
(The format of our PDB-style files is described here.)

Timeline for d1zrha_: