Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.7: SP0238-like [143381] (1 protein) stand-alone protein; dimer, the dimerization interface is formed by parallel packing of the subunit beta-sheets automatically mapped to Pfam PF13740 |
Protein UPF0237 protein SP0238 [143382] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143383] (1 PDB entry) Uniprot P67382 1-83 |
Domain d1zpva1: 1zpv A:1-83 [125475] Other proteins in same PDB: d1zpva2, d1zpvb3, d1zpvc3 complexed with k |
PDB Entry: 1zpv (more details), 1.9 Å
SCOPe Domain Sequences for d1zpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftylr nefeafgqtlnvkiniqsaaife
Timeline for d1zpva1:
View in 3D Domains from other chains: (mouse over for more information) d1zpvb2, d1zpvb3, d1zpvc2, d1zpvc3 |