Lineage for d1zpsa1 (1zps A:8-131)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.168: HisI-like [141733] (1 superfamily)
pseudo barrel, capped by an alpha-helix; contains a beta-triangle structure on one side; some topological similarity to the Ribosomal protein L25-like fold (50714) and the N-terminal domain of Glutamine synthetase (54368)Superfamily b.168.1: HisI-like [141734] (1 family) 
Family b.168.1.1: HisI-like [141735] (1 protein)
Pfam PF01502; PRA-CH; metalloenzyme, probable biological unit is dimericProtein Phosphoribosyl-AMP cyclohydrolase HisI [141736] (1 species) Species Methanobacterium thermoautotrophicum [TaxId:145262] [141737] (1 PDB entry)
Uniprot O26347 8-131
Domain d1zpsa1: 1zps A:8-131 [125473]
complexed with acy, cd
Details for d1zpsa1
PDB Entry: 1zps (more details), 1.7 Å
PDB Description: Crystal structure of Methanobacterium thermoautotrophicum phosphoribosyl-AMP cyclohydrolase HisI
PDB Compounds: (A:) Phosphoribosyl-AMP cyclohydrolaseSCOPe Domain Sequences for d1zpsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpsa1 b.168.1.1 (A:8-131) Phosphoribosyl-AMP cyclohydrolase HisI {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnillnfrhningedliiavaqdhetgevlmvaymnrealrrtletgtahywstsrgklw
lkgessghvqrvkdvlvdcdgdavvlkveqeggachtgyrscfyrsidgdelkvredavk
vfdp
SCOPe Domain Coordinates for d1zpsa1:
Click to download the PDB-style file with coordinates for d1zpsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zpsa1:
- d1zpsa1 first appeared in SCOP 1.73
- d1zpsa1 appears in SCOPe 2.07
View in 3D
