Class b: All beta proteins [48724] (180 folds) |
Fold b.168: HisI-like [141733] (1 superfamily) pseudo barrel, capped by an alpha-helix; contains a beta-triangle structure on one side; some topological similarity to the Ribosomal protein L25-like fold (50714) and the N-terminal domain of Glutamine synthetase (54368) |
Superfamily b.168.1: HisI-like [141734] (1 family) |
Family b.168.1.1: HisI-like [141735] (1 protein) Pfam PF01502; PRA-CH; metalloenzyme, probable biological unit is dimeric |
Protein Phosphoribosyl-AMP cyclohydrolase HisI [141736] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [141737] (1 PDB entry) Uniprot O26347 8-131 |
Domain d1zpsa1: 1zps A:8-131 [125473] complexed with acy, cd |
PDB Entry: 1zps (more details), 1.7 Å
SCOPe Domain Sequences for d1zpsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpsa1 b.168.1.1 (A:8-131) Phosphoribosyl-AMP cyclohydrolase HisI {Methanobacterium thermoautotrophicum [TaxId: 145262]} vnillnfrhningedliiavaqdhetgevlmvaymnrealrrtletgtahywstsrgklw lkgessghvqrvkdvlvdcdgdavvlkveqeggachtgyrscfyrsidgdelkvredavk vfdp
Timeline for d1zpsa1: