Lineage for d1zoyd_ (1zoy D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024622Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 3024642Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 3024684Protein Small cytochrome binding protein CybS [254391] (1 species)
    Pfam PF05328; PubMed 15989954
  7. 3024685Species Pig (Sus scrofa) [TaxId:9823] [254827] (5 PDB entries)
  8. 3024688Domain d1zoyd_: 1zoy D: [238607]
    Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb1, d1zoyb2, d1zoyc_
    complexed with eph, f3s, fad, fes, hem, sf4, uq1

Details for d1zoyd_

PDB Entry: 1zoy (more details), 2.4 Å

PDB Description: crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
PDB Compounds: (D:) Small cytochrome binding protein

SCOPe Domain Sequences for d1zoyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoyd_ f.21.2.2 (D:) Small cytochrome binding protein CybS {Pig (Sus scrofa) [TaxId: 9823]}
sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
dalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl

SCOPe Domain Coordinates for d1zoyd_:

Click to download the PDB-style file with coordinates for d1zoyd_.
(The format of our PDB-style files is described here.)

Timeline for d1zoyd_: