Lineage for d1zoyb2 (1zoy B:115-247)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2303053Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2303054Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2303085Protein Succinate dehydogenase [81669] (3 species)
  7. 2303111Species Pig (Sus scrofa) [TaxId:9823] [254765] (5 PDB entries)
  8. 2303112Domain d1zoyb2: 1zoy B:115-247 [230462]
    Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb1, d1zoyc_, d1zoyd_
    automated match to d2bs2b1
    complexed with eph, f3s, fad, fes, hem, sf4, uq1

Details for d1zoyb2

PDB Entry: 1zoy (more details), 2.4 Å

PDB Description: crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
PDB Compounds: (B:) Iron-sulfur protein

SCOPe Domain Sequences for d1zoyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoyb2 a.1.2.1 (B:115-247) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke

SCOPe Domain Coordinates for d1zoyb2:

Click to download the PDB-style file with coordinates for d1zoyb2.
(The format of our PDB-style files is described here.)

Timeline for d1zoyb2: