| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) ![]() |
| Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
| Protein Succinate dehydogenase [82818] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254824] (5 PDB entries) |
| Domain d1zoya2: 1zoy A:274-360 [238604] Other proteins in same PDB: d1zoya1, d1zoya3, d1zoyb1, d1zoyb2, d1zoyc_, d1zoyd_ complexed with eph, f3s, fad, fes, hem, sf4, uq1 |
PDB Entry: 1zoy (more details), 2.4 Å
SCOPe Domain Sequences for d1zoya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoya2 d.168.1.1 (A:274-360) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
gilinsqgerfmeryapvakdlasrdvvsrsmtleiregrgcgpekdhvylqlhhlppeq
lavrlpgisetamifagvdvtkepipv
Timeline for d1zoya2:
View in 3DDomains from other chains: (mouse over for more information) d1zoyb1, d1zoyb2, d1zoyc_, d1zoyd_ |