![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.7: Ornithine decarboxylase antizyme-like [143714] (2 proteins) Pfam PF02100; may have evolved different function; putative active site maps to the same location in the common fold |
![]() | Protein Ornithine decarboxylase antizyme [143715] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [143716] (1 PDB entry) Uniprot P54370 93-218 |
![]() | Domain d1zo0a1: 1zo0 A:94-219 [125416] |
PDB Entry: 1zo0 (more details)
SCOPe Domain Sequences for d1zo0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zo0a1 d.108.1.7 (A:94-219) Ornithine decarboxylase antizyme {Norway rat (Rattus norvegicus) [TaxId: 10116]} ilysderlnvteeptsndktrvlsiqctlteakqvtwravwnggglyielpagplpegsk dsfaallefaeeqlradhvficfpknredraallrtfsflgfeivrpghplvpkrpdacf mvytle
Timeline for d1zo0a1: