Lineage for d1zn8b_ (1zn8 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2143902Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2143903Protein Adenine PRTase [53288] (5 species)
  7. 2143911Species Human (Homo sapiens) [TaxId:9606] [102536] (6 PDB entries)
  8. 2143913Domain d1zn8b_: 1zn8 B: [125377]
    automated match to d1orea_
    complexed with amp, cl

Details for d1zn8b_

PDB Entry: 1zn8 (more details), 1.76 Å

PDB Description: Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution
PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d1zn8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zn8b_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

SCOPe Domain Coordinates for d1zn8b_:

Click to download the PDB-style file with coordinates for d1zn8b_.
(The format of our PDB-style files is described here.)

Timeline for d1zn8b_: