Lineage for d1zk8a1 (1zk8 A:6-77)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Transcriptional regulator BC5000 [140191] (1 species) Species Bacillus cereus [TaxId:1396] [140192] (1 PDB entry)
Uniprot Q815X4 6-77
Domain d1zk8a1: 1zk8 A:6-77 [125177]
Other proteins in same PDB: d1zk8a2, d1zk8b2
Details for d1zk8a1
PDB Entry: 1zk8 (more details), 2.15 Å
PDB Description: Crystal structure of transcriptional regulator from Bacillus cereus ATCC 14579
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILYSCOPe Domain Sequences for d1zk8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]}
igltlqkivetaaeiadangvqevtlaslaqtlgvrspslynhvkglqdvrknlgiygik
klhnrleeaaed
SCOPe Domain Coordinates for d1zk8a1:
Click to download the PDB-style file with coordinates for d1zk8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zk8a1:
- d1zk8a1 first appeared in SCOP 1.73
- d1zk8a1 appears in SCOPe 2.07
View in 3D
