Lineage for d1zk6a_ (1zk6 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509610Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2509611Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2509932Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2509933Protein automated matches [191162] (27 species)
    not a true protein
  7. 2509934Species Bacillus subtilis [TaxId:1423] [255009] (1 PDB entry)
  8. 2509935Domain d1zk6a_: 1zk6 A: [241140]
    automated match to d3ui4a_

Details for d1zk6a_

PDB Entry: 1zk6 (more details)

PDB Description: NMR solution structure of B. subtilis PrsA PPIase
PDB Compounds: (A:) Foldase protein prsA

SCOPe Domain Sequences for d1zk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk6a_ d.26.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
gkirashilvadkktaeevekklkkgekfedlakeystdssaskggdlgwfakegqmdet
fskaafklktgevsdpvktqygyhiikktee

SCOPe Domain Coordinates for d1zk6a_:

Click to download the PDB-style file with coordinates for d1zk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1zk6a_: