Lineage for d1zjda1 (1zjd A:16-244)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793669Protein Coagulation factor XI [117237] (1 species)
  7. 1793670Species Human (Homo sapiens) [TaxId:9606] [117238] (32 PDB entries)
    Uniprot P03951 388-624
  8. 1793701Domain d1zjda1: 1zjd A:16-244 [144741]
    Other proteins in same PDB: d1zjdb_

Details for d1zjda1

PDB Entry: 1zjd (more details), 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with kunitz protease inhibitor domain of protease nexin ii
PDB Compounds: (A:) Catalytic Domain of Coagulation Factor XI

SCOPe Domain Sequences for d1zjda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjda1 b.47.1.2 (A:16-244) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1zjda1:

Click to download the PDB-style file with coordinates for d1zjda1.
(The format of our PDB-style files is described here.)

Timeline for d1zjda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zjdb_