| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) ![]() duplication: contains two subdomains of this fold |
| Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (5 proteins) |
| Domain d1zj8a2: 1zj8 A:10-161 [146004] Other proteins in same PDB: d1zj8a1, d1zj8a3, d1zj8a4, d1zj8b1, d1zj8b3, d1zj8b4 complexed with cl, sf4, srm has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1zj8 (more details), 2.8 Å
SCOPe Domain Sequences for d1zj8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zj8a2 d.58.36.1 (A:10-161) Sulfite reductase NirA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
rnegqwalghreplnaneelkkagnpldvrerieniyakqgfdsidktdlrgrfrwwgly
tqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaalrtlgqistefardtadisd
rqnvqyhwievenvpeiwrrlddvglqtteac
Timeline for d1zj8a2:
View in 3DDomains from other chains: (mouse over for more information) d1zj8b1, d1zj8b2, d1zj8b3, d1zj8b4 |