Lineage for d1zhha_ (1zhh A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topologyFamily c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
has additional insertions and/or extensions that are not grouped together
Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species) Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries) 
Domain d1zhha_: 1zhh A: [125095]
Other proteins in same PDB: d1zhhb1
automated match to d1jx6a_
complexed with nhe
has additional insertions and/or extensions that are not grouped together
Details for d1zhha_
PDB Entry: 1zhh (more details), 1.94 Å
PDB Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ
PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxPSCOPe Domain Sequences for d1zhha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhha_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
tqvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdy
wvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhr
kfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyy
svlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfi
yacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamae
aikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
SCOPe Domain Coordinates for d1zhha_:
Click to download the PDB-style file with coordinates for d1zhha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zhha_:
- d1zhha_ first appeared in SCOP 1.73, called d1zhha1
- d1zhha_ appears in SCOPe 2.07
View in 3D
