Lineage for d1zh8a1 (1zh8 A:4-131,A:276-328)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Hypothetical protein TM0312 [141925] (1 species) Species Thermotoga maritima [TaxId:2336] [141926] (1 PDB entry)
Uniprot Q9WYE8 4-131,276-328
Domain d1zh8a1: 1zh8 A:4-131,A:276-328 [125077]
Other proteins in same PDB: d1zh8a2, d1zh8b2
complexed with edo, na, nap
Details for d1zh8a1
PDB Entry: 1zh8 (more details), 2.5 Å
PDB Description: Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (A:) OxidoreductaseSCOPe Domain Sequences for d1zh8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]}
lrkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaeefakmvgnpavfdsye
ellesglvdavdltlpvelnlpfiekalrkgvhvicekpistdvetgkkvvelseksekt
vyiaenfrXensyqkefedfyqvvaegkpndlgspvqalkdlafieacvrsagnkvfvss
ll
SCOPe Domain Coordinates for d1zh8a1:
Click to download the PDB-style file with coordinates for d1zh8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zh8a1:
- d1zh8a1 first appeared in SCOP 1.73
- d1zh8a1 appears in SCOPe 2.06
- d1zh8a1 appears in the current release, SCOPe 2.08
View in 3D
