Lineage for d1zh5a2 (1zh5 A:104-189)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2558816Protein Lupus LA protein [89940] (1 species)
  7. 2558817Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 2558818Domain d1zh5a2: 1zh5 A:104-189 [125074]
    Other proteins in same PDB: d1zh5a1, d1zh5b1
    automated match to d1zh5a2
    protein/RNA complex; complexed with so4

Details for d1zh5a2

PDB Entry: 1zh5 (more details), 1.85 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d1zh5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh5a2 d.58.7.1 (A:104-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
ykndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsies
akkfvetpgqkyketdllilfkddyf

SCOPe Domain Coordinates for d1zh5a2:

Click to download the PDB-style file with coordinates for d1zh5a2.
(The format of our PDB-style files is described here.)

Timeline for d1zh5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zh5a1