Lineage for d1zgha1 (1zgh A:165-226)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404074Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2404075Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2404076Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 2404083Protein Methionyl-tRNAfmet formyltransferase, C-terminal domain [50488] (2 species)
  7. 2404084Species Clostridium thermocellum [TaxId:1515] [117236] (2 PDB entries)
    Uniprot Q4HJX2; 47% sequence identity; truncated C-terminal domain
    Structural genomics target; GI:67850689
  8. 2404086Domain d1zgha1: 1zgh A:165-226 [125028]
    Other proteins in same PDB: d1zgha2, d1zgha3
    complexed with unx

Details for d1zgha1

PDB Entry: 1zgh (more details), 2.05 Å

PDB Description: methionyl-trna formyltransferase from clostridium thermocellum
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d1zgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgha1 b.46.1.1 (A:165-226) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}
rkpeqseispdfdlekiydyirmldgegyprafikygkyrlefsrasmkngkiiadveii
eg

SCOPe Domain Coordinates for d1zgha1:

Click to download the PDB-style file with coordinates for d1zgha1.
(The format of our PDB-style files is described here.)

Timeline for d1zgha1: