Lineage for d1zgha1 (1zgh A:165-226)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802010Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 802011Superfamily b.46.1: FMT C-terminal domain-like [50486] (2 families) (S)
  5. 802012Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 802019Protein Methionyl-tRNAfmet formyltransferase, C-terminal domain [50488] (2 species)
  7. 802020Species Clostridium thermocellum [TaxId:1515] [117236] (1 PDB entry)
    Uniprot Q4HJX2; 47% sequence identity; truncated C-terminal domain
    Structural genomics target; GI:67850689
  8. 802021Domain d1zgha1: 1zgh A:165-226 [125028]
    Other proteins in same PDB: d1zgha2
    complexed with unx

Details for d1zgha1

PDB Entry: 1zgh (more details), 2.05 Å

PDB Description: methionyl-trna formyltransferase from clostridium thermocellum
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOP Domain Sequences for d1zgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgha1 b.46.1.1 (A:165-226) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}
rkpeqseispdfdlekiydyirmldgegyprafikygkyrlefsrasmkngkiiadveii
eg

SCOP Domain Coordinates for d1zgha1:

Click to download the PDB-style file with coordinates for d1zgha1.
(The format of our PDB-style files is described here.)

Timeline for d1zgha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgha2