| Class b: All beta proteins [48724] (174 folds) |
| Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (2 families) ![]() |
| Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins) |
| Protein Methionyl-tRNAfmet formyltransferase, C-terminal domain [50488] (2 species) |
| Species Clostridium thermocellum [TaxId:1515] [117236] (1 PDB entry) Uniprot Q4HJX2; 47% sequence identity; truncated C-terminal domain Structural genomics target; GI:67850689 |
| Domain d1zgha1: 1zgh A:165-226 [125028] Other proteins in same PDB: d1zgha2 complexed with unx |
PDB Entry: 1zgh (more details), 2.05 Å
SCOP Domain Sequences for d1zgha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgha1 b.46.1.1 (A:165-226) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}
rkpeqseispdfdlekiydyirmldgegyprafikygkyrlefsrasmkngkiiadveii
eg
Timeline for d1zgha1: