Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein Mannose-specific adhesin FimH [49406] (1 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
Species Escherichia coli [TaxId:562] [49407] (21 PDB entries) |
Domain d1ze3h1: 1ze3 H:159-279 [124977] Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3d1 automatically matched to d1kiub2 complexed with edo |
PDB Entry: 1ze3 (more details), 1.84 Å
SCOPe Domain Sequences for d1ze3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ze3h1 b.2.3.2 (H:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]} ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy q
Timeline for d1ze3h1: