![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
![]() | Protein Hypothetical oxidoreductase YcnD [143614] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143615] (1 PDB entry) Uniprot P94424 1-249 |
![]() | Domain d1zcha1: 1zch A:1-249 [124908] complexed with ca, cl, fmn |
PDB Entry: 1zch (more details), 1.85 Å
SCOPe Domain Sequences for d1zcha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcha1 d.90.1.1 (A:1-249) Hypothetical oxidoreductase YcnD {Bacillus subtilis [TaxId: 1423]} mneviksltdhrsirsytdepvaqeqldqiieavqsapssingqqvtvitvqdkerkkki selaggqpwidqapvfllfcadfnrakialedlhdfkmeitnglesvlvgavdagialgt ataaaeslglgtvpigavrgnpqeliellelpkyvfplsglvighpadrsakkprlpqea vnhqetylnqdeltshiqaydeqmseymnkrtngketrnwsqsiasyyerlyyphireml ekqgfkvek
Timeline for d1zcha1: