Lineage for d1zcha1 (1zch A:1-249)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963300Protein Hypothetical oxidoreductase YcnD [143614] (1 species)
  7. 2963301Species Bacillus subtilis [TaxId:1423] [143615] (1 PDB entry)
    Uniprot P94424 1-249
  8. 2963302Domain d1zcha1: 1zch A:1-249 [124908]
    complexed with ca, cl, fmn

Details for d1zcha1

PDB Entry: 1zch (more details), 1.85 Å

PDB Description: structure of the hypothetical oxidoreductase ycnd from bacillus subtilis
PDB Compounds: (A:) Hypothetical oxidoreductase ycnD

SCOPe Domain Sequences for d1zcha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcha1 d.90.1.1 (A:1-249) Hypothetical oxidoreductase YcnD {Bacillus subtilis [TaxId: 1423]}
mneviksltdhrsirsytdepvaqeqldqiieavqsapssingqqvtvitvqdkerkkki
selaggqpwidqapvfllfcadfnrakialedlhdfkmeitnglesvlvgavdagialgt
ataaaeslglgtvpigavrgnpqeliellelpkyvfplsglvighpadrsakkprlpqea
vnhqetylnqdeltshiqaydeqmseymnkrtngketrnwsqsiasyyerlyyphireml
ekqgfkvek

SCOPe Domain Coordinates for d1zcha1:

Click to download the PDB-style file with coordinates for d1zcha1.
(The format of our PDB-style files is described here.)

Timeline for d1zcha1: