![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries) Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372 |
![]() | Domain d1zcba2: 1zcb A:47-75,A:202-372 [124902] Other proteins in same PDB: d1zcba1 G alpha i/13 complexed with gdp |
PDB Entry: 1zcb (more details), 2 Å
SCOPe Domain Sequences for d1zcba2:
Sequence, based on SEQRES records: (download)
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggqrserk rwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilfln ktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqqrplyhhfttain tenirlvfrdvkdtilhdnlk
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggwfecfd svtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilflnktdllee kvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqplyhhfttaintenirlvfr dvkdtilhdnlk
Timeline for d1zcba2: