| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries) Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201 |
| Domain d1zcba1: 1zcb A:76-201 [124901] Other proteins in same PDB: d1zcba2, d1zcba3 G alpha i/13 complexed with gdp |
PDB Entry: 1zcb (more details), 2 Å
SCOPe Domain Sequences for d1zcba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illarr
Timeline for d1zcba1: