![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Exocyst complex protein EXO84 [141399] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [141400] (1 PDB entry) Uniprot O54924 171-283 |
![]() | Domain d1zc4b1: 1zc4 B:171-283 [124885] Other proteins in same PDB: d1zc4a_, d1zc4c_, d1zc4d_ complexed with gnp, mg |
PDB Entry: 1zc4 (more details), 2.5 Å
SCOPe Domain Sequences for d1zc4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc4b1 b.55.1.1 (B:171-283) Exocyst complex protein EXO84 {Norway rat (Rattus norvegicus) [TaxId: 10116]} gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreq
Timeline for d1zc4b1: