Lineage for d1zbfa1 (1zbf A:62-193)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 836758Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 836759Protein BH0863-like Ribonuclease H [142490] (1 species)
    new class of RNase H
  7. 836760Species Bacillus halodurans [TaxId:86665] [142491] (12 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 836761Domain d1zbfa1: 1zbf A:62-193 [124850]
    complexed with so4; mutant

Details for d1zbfa1

PDB Entry: 1zbf (more details), 1.5 Å

PDB Description: crystal structure of b. halodurans rnase h catalytic domain mutant d132n
PDB Compounds: (A:) ribonuclease H-related protein

SCOP Domain Sequences for d1zbfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikady

SCOP Domain Coordinates for d1zbfa1:

Click to download the PDB-style file with coordinates for d1zbfa1.
(The format of our PDB-style files is described here.)

Timeline for d1zbfa1: