Lineage for d1zata2 (1zat A:217-338)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily)
unusual fold, made of four helices and four 2-3 stranded beta-sheetsSuperfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) 
automatically mapped to Pfam PF12229Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (1 protein) Protein L,D-transpeptidase, pre-catalytic domain [143987] (1 species) Species Enterococcus faecium [TaxId:1352] [143988] (2 PDB entries)
Uniprot Q3Y185 217-338
Domain d1zata2: 1zat A:217-338 [124846]
Other proteins in same PDB: d1zata1
complexed with so4, zn
Details for d1zata2
PDB Entry: 1zat (more details), 2.4 Å
PDB Description: Crystal Structure of an Enterococcus faecium peptidoglycan binding protein at 2.4 A resolution
PDB Compounds: (A:) L,D-transpeptidaseSCOPe Domain Sequences for d1zata2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zata2 d.335.1.1 (A:217-338) L,D-transpeptidase, pre-catalytic domain {Enterococcus faecium [TaxId: 1352]}
keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
hp
SCOPe Domain Coordinates for d1zata2:
Click to download the PDB-style file with coordinates for d1zata2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zata2:
- d1zata2 first appeared in SCOP 1.73
- d1zata2 appears in SCOPe 2.03
- d1zata2 appears in SCOPe 2.05
- d1zata2 appears in the current release, SCOPe 2.08
View in 3D
