![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) ![]() |
![]() | Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins) N-terminal part of PfamB PB012949 |
![]() | Protein PC4 and SFRS1-interacting protein, PSIP1 [140578] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140579] (2 PDB entries) Uniprot O75475 346-426! Uniprot O75475 347-429 |
![]() | Domain d1z9ea1: 1z9e A:347-429 [124756] |
PDB Entry: 1z9e (more details)
SCOPe Domain Sequences for d1z9ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9ea1 a.48.4.1 (A:347-429) PC4 and SFRS1-interacting protein, PSIP1 {Human (Homo sapiens) [TaxId: 9606]} smdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrf kvsqvimekstmlynkfknmflv
Timeline for d1z9ea1: