Lineage for d1z91a1 (1z91 A:8-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693737Protein Organic hydroperoxide resistance transcriptional regulator OhrR [140247] (1 species)
  7. 2693738Species Bacillus subtilis [TaxId:1423] [140248] (2 PDB entries)
    Uniprot O34777 8-144
  8. 2693739Domain d1z91a1: 1z91 A:8-144 [124736]

Details for d1z91a1

PDB Entry: 1z91 (more details), 2.5 Å

PDB Description: x-ray crystal structure of apo-ohrrc15s in reduced form: marr family protein
PDB Compounds: (A:) Organic hydroperoxide resistance transcriptional regulator

SCOPe Domain Sequences for d1z91a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]}
mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
dlkqlksalytlletlh

SCOPe Domain Coordinates for d1z91a1:

Click to download the PDB-style file with coordinates for d1z91a1.
(The format of our PDB-style files is described here.)

Timeline for d1z91a1: