Lineage for d1z8ka1 (1z8k A:20-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825302Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 2825303Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 2825304Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 2825305Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 2825308Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
    Uniprot Q9LS02 80-253
  8. 2825322Domain d1z8ka1: 1z8k A:20-193 [124703]

Details for d1z8ka1

PDB Entry: 1z8k (more details), 1.71 Å

PDB Description: x-ray structure of allene oxide cyclase from arabidopsis thaliana at3g25770
PDB Compounds: (A:) At3g25770 protein

SCOPe Domain Sequences for d1z8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ka1 b.159.1.1 (A:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOPe Domain Coordinates for d1z8ka1:

Click to download the PDB-style file with coordinates for d1z8ka1.
(The format of our PDB-style files is described here.)

Timeline for d1z8ka1: