Lineage for d1z77a2 (1z77 A:76-200)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Transcriptional regulator TM1030 [140877] (1 species) Species Thermotoga maritima [TaxId:2336] [140878] (8 PDB entries)
Uniprot Q9X0C0 76-200
Domain d1z77a2: 1z77 A:76-200 [124589]
Other proteins in same PDB: d1z77a1
complexed with edo
Details for d1z77a2
PDB Entry: 1z77 (more details), 2 Å
PDB Description: crystal structure of transcriptional regulator protein from thermotoga maritima.
PDB Compounds: (A:) transcriptional regulator (TetR family)SCOPe Domain Sequences for d1z77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z77a2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk
SCOPe Domain Coordinates for d1z77a2:
Click to download the PDB-style file with coordinates for d1z77a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z77a2:
- d1z77a2 first appeared in SCOP 1.73
- d1z77a2 appears in SCOPe 2.05
- d1z77a2 appears in SCOPe 2.07
- d1z77a2 appears in the current release, SCOPe 2.08
View in 3D
