Lineage for d1z77a1 (1z77 A:1-75)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 905282Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 905661Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 905881Protein Transcriptional regulator TM1030 [140209] (1 species)
  7. 905882Species Thermotoga maritima [TaxId:2336] [140210] (4 PDB entries)
    Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
  8. 905885Domain d1z77a1: 1z77 A:1-75 [124588]
    Other proteins in same PDB: d1z77a2
    complexed with edo

Details for d1z77a1

PDB Entry: 1z77 (more details), 2 Å

PDB Description: crystal structure of transcriptional regulator protein from thermotoga maritima.
PDB Compounds: (A:) transcriptional regulator (TetR family)

SCOPe Domain Sequences for d1z77a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z77a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
klqkefenflmknrn

SCOPe Domain Coordinates for d1z77a1:

Click to download the PDB-style file with coordinates for d1z77a1.
(The format of our PDB-style files is described here.)

Timeline for d1z77a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z77a2