Lineage for d1z6xa1 (1z6x A:4-178)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (81 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein ADP-ribosylation factor [52614] (17 species) 
Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry)
Uniprot P18085 3-177
Domain d1z6xa1: 1z6x A:4-178 [124571]
complexed with gdp, mg
Details for d1z6xa1
PDB Entry: 1z6x (more details), 2.7 Å
PDB Description: Structure Of Human ADP-Ribosylation Factor 4
PDB Compounds: (A:) ADP-ribosylation factor 4SCOPe Domain Sequences for d1z6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6xa1 c.37.1.8 (A:4-178) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]}
tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels
SCOPe Domain Coordinates for d1z6xa1:
Click to download the PDB-style file with coordinates for d1z6xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z6xa1:
- d1z6xa1 first appeared in SCOP 1.73
- d1z6xa1 appears in SCOPe 2.07
View in 3D
