Lineage for d1z6oa1 (1z6o A:13-212)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 910728Protein (Apo)ferritin [47246] (8 species)
  7. 910762Species Cabbage looper (Trichoplusia ni), L chain [TaxId:7111] [140436] (1 PDB entry)
    Uniprot Q52SA8 1-200
  8. 910763Domain d1z6oa1: 1z6o A:13-212 [124531]
    Other proteins in same PDB: d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6on_, d1z6oo_, d1z6op_, d1z6oq_, d1z6or_, d1z6os_, d1z6ot_, d1z6ou_, d1z6ov_, d1z6ow_, d1z6ox_
    complexed with ca, fe

Details for d1z6oa1

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d1z6oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper (Trichoplusia ni), L chain [TaxId: 7111]}
gitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaayfnnyqtnragf
sklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaenhelealakaldt
qkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlaghtsdlkkfitan
nghdlslalyvfdeylqktv

SCOPe Domain Coordinates for d1z6oa1:

Click to download the PDB-style file with coordinates for d1z6oa1.
(The format of our PDB-style files is described here.)

Timeline for d1z6oa1: