Lineage for d1z63a1 (1z63 A:432-661)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478770Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2478831Protein Helicase of the SNF2/Rad54 hamily [142312] (1 species)
  7. 2478832Species Sulfolobus solfataricus [TaxId:2287] [142313] (2 PDB entries)
    Uniprot Q97XQ7 432-661! Uniprot Q97XQ7 662-802! Uniprot Q97XQ7 663-802
  8. 2478835Domain d1z63a1: 1z63 A:432-661 [124502]
    Other proteins in same PDB: d1z63b1, d1z63b2
    protein/DNA complex

Details for d1z63a1

PDB Entry: 1z63 (more details), 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core in complex with dsdna
PDB Compounds: (A:) Helicase of the snf2/rad54 family

SCOPe Domain Sequences for d1z63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene
ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl
kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg
llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlp

SCOPe Domain Coordinates for d1z63a1:

Click to download the PDB-style file with coordinates for d1z63a1.
(The format of our PDB-style files is described here.)

Timeline for d1z63a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z63a2