Lineage for d1z5zb_ (1z5z B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
duplication: tandem repeat of two RecA-like (AAA) domains
Protein Helicase of the SNF2/Rad54 hamily [142312] (1 species) Species Sulfolobus solfataricus [TaxId:2287] [142313] (2 PDB entries)
Uniprot Q97XQ7 432-661! Uniprot Q97XQ7 662-802! Uniprot Q97XQ7 663-802
Domain d1z5zb_: 1z5z B: [124500]
automated match to d1z5za1
has additional insertions and/or extensions that are not grouped together
Details for d1z5zb_
PDB Entry: 1z5z (more details), 2 Å
PDB Description: sulfolobus solfataricus swi2/snf2 atpase c-terminal domain
PDB Compounds: (B:) Helicase of the snf2/rad54 familySCOPe Domain Sequences for d1z5zb_:
Sequence, based on SEQRES records: (download)
>d1z5zb_ c.37.1.19 (B:) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
lskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwnpavedqatdrv
yrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdswitelsteelrkviel
sv
Sequence, based on observed residues (ATOM records): (download)
>d1z5zb_ c.37.1.19 (B:) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
lskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwnpavenvivhkl
isvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsv
SCOPe Domain Coordinates for d1z5zb_:
Click to download the PDB-style file with coordinates for d1z5zb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z5zb_:
- d1z5zb_ first appeared in SCOP 1.73, called d1z5zb1
- d1z5zb_ appears in SCOPe 2.07
View in 3D
