![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Interferon-induced 15 kDa protein [142936] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142937] (1 PDB entry) Uniprot P05161 2-77! Uniprot P05161 78-153 |
![]() | Domain d1z2ma2: 1z2m A:79-154 [124388] complexed with os4 |
PDB Entry: 1z2m (more details), 2.5 Å
SCOPe Domain Sequences for d1z2ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg eyglkplstvfmnlrl
Timeline for d1z2ma2: