Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Allantoate amidohydrolase AllC catalytic domain [142514] (1 species) |
Species Escherichia coli [TaxId:562] [142515] (2 PDB entries) Uniprot P77425 2-210,328-411 |
Domain d1z2la1: 1z2l A:4-212,A:330-413 [124383] Other proteins in same PDB: d1z2la2, d1z2la3, d1z2lb2, d1z2lb3 complexed with 1al, so4, zn |
PDB Entry: 1z2l (more details), 2.25 Å
SCOPe Domain Sequences for d1z2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2la1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]} ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgn lygrlngteypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevv amaeeegsrfpyvfwgsknifglanpddvrnicdakgnsfvdamkacgftlpnapltprq dikafvelhieqgcvlesngqsigvvnaiXvpmnkelvatltelcereklnyrvmhsgag hdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawqk
Timeline for d1z2la1: