| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
| Protein automated matches [254465] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [254996] (2 PDB entries) |
| Domain d1z1ma_: 1z1m A: [241100] automated match to d4hbma_ |
PDB Entry: 1z1m (more details)
SCOPe Domain Sequences for d1z1ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1ma_ a.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdss
Timeline for d1z1ma_: