Lineage for d1z1ma_ (1z1m A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735237Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1735358Protein automated matches [254465] (1 species)
    not a true protein
  7. 1735359Species Human (Homo sapiens) [TaxId:9606] [254996] (2 PDB entries)
  8. 1735361Domain d1z1ma_: 1z1m A: [241100]
    automated match to d4hbma_

Details for d1z1ma_

PDB Entry: 1z1m (more details)

PDB Description: nmr structure of unliganded mdm2
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1z1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1ma_ a.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdss

SCOPe Domain Coordinates for d1z1ma_:

Click to download the PDB-style file with coordinates for d1z1ma_.
(The format of our PDB-style files is described here.)

Timeline for d1z1ma_: