Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Transcriptional regulator EF0787 [140183] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [140184] (1 PDB entry) Uniprot Q837P6 4-71 |
Domain d1z0xa1: 1z0x A:4-71 [124334] Other proteins in same PDB: d1z0xa2, d1z0xb2 complexed with cl |
PDB Entry: 1z0x (more details), 2.4 Å
SCOPe Domain Sequences for d1z0xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} klskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaeaiee hfqepalc
Timeline for d1z0xa1: