Lineage for d1z00a1 (1z00 A:220-297)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.60: SAM domain-like [47768] (17 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) 
duplication: contains two helix-hairpin-helix (HhH) motifsFamily a.60.2.5: Hef domain-like [140629] (4 proteins)
helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
Protein DNA excision repair protein ERCC-1 [140630] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140631] (3 PDB entries)
Uniprot P07992 219-296! Uniprot P07992 220-297
Domain d1z00a1: 1z00 A:220-297 [124294]
Other proteins in same PDB: d1z00a2, d1z00b1
Details for d1z00a1
PDB Entry: 1z00 (more details)
PDB Description: solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
PDB Compounds: (A:) DNA excision repair protein ERCC-1SCOPe Domain Sequences for d1z00a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z00a1 a.60.2.5 (A:220-297) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
adllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglgp
qkarrlfdvlhepflkvp
SCOPe Domain Coordinates for d1z00a1:
Click to download the PDB-style file with coordinates for d1z00a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z00a1:
- d1z00a1 first appeared in SCOP 1.73
- d1z00a1 appears in SCOPe 2.07
View in 3D
