Lineage for d1yzzb_ (1yzz B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2023922Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2023963Domain d1yzzb_: 1yzz B: [193841]
    automated match to d1yc7b_

Details for d1yzzb_

PDB Entry: 1yzz (more details), 2.7 Å

PDB Description: Humanized caban33 at room temperature
PDB Compounds: (B:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yzzb_:

Sequence, based on SEQRES records: (download)

>d1yzzb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d1yzzb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvireywgqgtqvtvs

SCOPe Domain Coordinates for d1yzzb_:

Click to download the PDB-style file with coordinates for d1yzzb_.
(The format of our PDB-style files is described here.)

Timeline for d1yzzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yzza_