Lineage for d1yyva1 (1yyv A:9-122)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.69: HxlR-like [140304] (6 proteins)
Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
Protein Putative transcriptional regulator YtfH [140311] (1 species) Species Salmonella typhimurium [TaxId:90371] [140312] (1 PDB entry)
Uniprot Q7CP90 9-122
Domain d1yyva1: 1yyv A:9-122 [124254]
complexed with cl
Details for d1yyva1
PDB Entry: 1yyv (more details), 2.35 Å
PDB Description: Putative transcriptional regulator ytfH from Salmonella typhimurium
PDB Compounds: (A:) Putative transcriptional regulatorSCOPe Domain Sequences for d1yyva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]}
qlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslq
aleqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqre
SCOPe Domain Coordinates for d1yyva1:
Click to download the PDB-style file with coordinates for d1yyva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yyva1:
- d1yyva1 first appeared in SCOP 1.73
- d1yyva1 appears in SCOPe 2.07
View in 3D
