Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.7: KguE-like [141854] (1 protein) part of Pfam PF01261 |
Protein Hypothetical protein PA2260 [141855] (1 species) 2-ketogluconate utilization operon protein KguE |
Species Pseudomonas aeruginosa [TaxId:287] [141856] (1 PDB entry) Uniprot Q9I1L3 3-252 |
Domain d1yx1a1: 1yx1 A:3-252 [124169] complexed with ipa, na |
PDB Entry: 1yx1 (more details), 1.8 Å
SCOPe Domain Sequences for d1yx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr hiaalarlgq
Timeline for d1yx1a1: