Lineage for d1ywza1 (1ywz A:1-167)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857214Family d.20.1.4: UFC1-like [143072] (1 protein)
  6. 857215Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
    aka cgi-126
  7. 857216Species Human (Homo sapiens) [TaxId:9606] [143074] (2 PDB entries)
    Uniprot Q9Y3C8 1-167
  8. 857219Domain d1ywza1: 1ywz A:1-167 [124167]

Details for d1ywza1

PDB Entry: 1ywz (more details)

PDB Description: Solution Structure of Human Ubiquitin-fold Modifier-Conjugating Enzyme 1(UFC1): The Northeast Structural Genomics Consortium Target HR41
PDB Compounds: (A:) Protein CGI-126

SCOP Domain Sequences for d1ywza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywza1 d.20.1.4 (A:1-167) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnq

SCOP Domain Coordinates for d1ywza1:

Click to download the PDB-style file with coordinates for d1ywza1.
(The format of our PDB-style files is described here.)

Timeline for d1ywza1: