Details for d1ywha1

PDB Entry: 1ywh (more details), 2.7 Å

PDB Compounds: (A:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d1ywha1:

Sequence, based on SEQRES records: (download)

>d1ywha1 g.7.1.3 (A:89-188) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
rsryleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcg
ylpgcpgsngfhnndtfhflkccnttkcnegpilelenlp

Sequence, based on observed residues (ATOM records): (download)

>d1ywha1 g.7.1.3 (A:89-188) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
rsryleciscgssdmscergrhqslqcrspeeqcldvvthwiqrpkddrhlrgcgylpgc
pgsngfhnndtfhflkccnttkcnegpilelenlp

SCOPe Domain Coordinates for d1ywha1:

Timeline for d1ywha1:

• d1ywha1 first appeared in SCOP 1.75
  
• d1ywha1 appears in SCOPe 2.02
  
• d1ywha1 appears in SCOPe 2.04
  
• d1ywha1 appears in the current release, SCOPe 2.08
  

Thumbnails for d1ywha1:

d1ywha1 (click for larger image) View in 3D

d1ywha1 in context of chain d1ywha2 in context of chain d1ywha3 in context of chain View in 3D Domains from same chain: (mouse over for more information) d1ywha2, d1ywha3

d1ywha1 in context of PDB d1ywhc1 in context of PDB d1ywhc2 in context of PDB d1ywhc3 in context of PDB d1ywhe1 in context of PDB d1ywhe2 in context of PDB d1ywhe3 in context of PDB d1ywhg1 in context of PDB d1ywhg2 in context of PDB d1ywhg3 in context of PDB d1ywhi1 in context of PDB d1ywhi2 in context of PDB d1ywhi3 in context of PDB d1ywhk1 in context of PDB d1ywhk2 in context of PDB d1ywhk3 in context of PDB d1ywhm1 in context of PDB d1ywhm2 in context of PDB d1ywhm3 in context of PDB d1ywho1 in context of PDB d1ywho2 in context of PDB d1ywho3 in context of PDB View in 3D Domains from other chains: (mouse over for more information) d1ywhc1, d1ywhc2, d1ywhc3, d1ywhe1, d1ywhe2, d1ywhe3, d1ywhg1, d1ywhg2, d1ywhg3, d1ywhi1, d1ywhi2, d1ywhi3, d1ywhk1, d1ywhk2, d1ywhk3, d1ywhm1, d1ywhm2, d1ywhm3, d1ywho1, d1ywho2, d1ywho3