![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein Falcipain 2 [142846] (1 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (5 PDB entries) Uniprot Q9N6S8 244-484 |
![]() | Domain d1yvba1: 1yvb A:0-212 [124092] Other proteins in same PDB: d1yvbi_ complexed with gol |
PDB Entry: 1yvb (more details), 2.7 Å
SCOPe Domain Sequences for d1yvba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvba1 d.3.1.1 (A:0-212) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli e
Timeline for d1yvba1: